PMP22 Polyclonal antibody

• 

PMP22 Polyclonal Antibody for ELISA

Cat No. 16391-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

CMT1A, CMT1E, DSS, GAS 3, GAS3, HMSNIA, HNPP, peripheral myelin protein 22, PMP 22, PMP22, Sp110

---

Product Information

16391-1-AP targets PMP22 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9461

  Product name: Recombinant human PMP22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-133 aa of BC019040

  Sequence: GNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYG

• Full Name: peripheral myelin protein 22
• Calculated Molecular Weight: 160 aa, 18 kDa
• GenBank Accession Number: BC019040
• Gene Symbol: PMP22
• Gene ID (NCBI): 5376
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01453
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.