PMS1 Recombinant monoclonal antibody

PMS1 Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 83456-6-RR
Clone No.240408D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

PMSL1, MLH2, hPMS1, HNPCC3, 240408D9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293T cells, K-562 cells, Jurkat cells, MOLT-4 cells, HL-60 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, Caco-2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83456-6-RR targets PMS1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28132

Product name: Recombinant human PMS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 340-616 aa of BC096331

Sequence: LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE

Predict reactive species
Full Name PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
Observed Molecular Weight 106 kDa
GenBank Accession NumberBC096331
Gene Symbol PMS1
Gene ID (NCBI) 5378
RRIDAB_3671092
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP54277
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PMS1 Homolog 1 is a member of the DNA mismatch repair enzymes (MMREs) which is to eliminate the mismatch of insertions and deletions as a consequence of DNA polymerase errors at DNA synthesis in eukaryotes. PMS1 and MLH1 could form a heterodimer MutLβ that belongs to MMREs (PMID:25619773). In the MMR system, the MutS complex recognizes the DNA mispairs firstly, and then the Mlh1-Pms1 and other associated proteins such as PCNA, RFC, ExoI were recruited, inducing Exonuclease 1 (Exo1)-dependent and -independent MMR pathways (PMID:24981171). Mutations in this gene cause hereditary nonpolyposis colorectal cancer(HNPCC), which is also known as Lynch syndrome. It was reported that PMS1 is a widely expressed protein and located in the nucleus. Alternative splicing allows for 4 isoforms of PMS1 protein.

Protocols

Product Specific Protocols
FC protocol for PMS1 antibody 83456-6-RRDownload protocol
IF protocol for PMS1 antibody 83456-6-RRDownload protocol
IHC protocol for PMS1 antibody 83456-6-RRDownload protocol
WB protocol for PMS1 antibody 83456-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...