PMVK Polyclonal antibody

• 

  WB analysis using 15674-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15674-1-AP (PMVK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15674-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15674-1-AP (PMVK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 15674-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15674-1-AP (PMVK Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver cancer using 15674-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15674-1-AP (PMVK Antibody) at dilution of 1:200 (under 40x lens).

PMVK Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15674-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

hPMK, HUMPMKI, phosphomevalonate kinase, PMK, PMKA, PMKASE, PMKI, PMVK

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

15674-1-AP targets PMVK in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8141

  Product name: Recombinant human PMVK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC007694

  Sequence: MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL

• Full Name: phosphomevalonate kinase
• Calculated Molecular Weight: 192 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC007694
• Gene Symbol: PMVK
• Gene ID (NCBI): 10654
• RRID: AB_2299910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15126
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Loss-of-function Mutation in PMVK Causes Autosomal Dominant Disseminated Superficial Porokeratosis.; Authors - Jiuxiang Wang
human	WB	Sci Rep; MicroRNA-874 targets phosphomevalonate kinase and inhibits cancer cell growth via the mevalonate pathway; Authors - Alimasi Aersilan