PNLDC1 Polyclonal antibody

• 

  WB analysis using 25559-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25559-1-AP (PNLDC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 25559-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25559-1-AP (PNLDC1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 25559-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25559-1-AP (PNLDC1 Antibody) at dilution of 1:50 (under 10x lens).

PNLDC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25559-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

PNLDC1

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

25559-1-AP targets PNLDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, silkworm
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22074

  Product name: Recombinant human PNLDC1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 19-371 aa of BC112246

  Sequence: EFTGLRSNLSGPQQISLFDLPSEWYLKTRQSVQQFTVCQIGLSVFSAIEGEANKYIAHSCNFYLFPTTFGILDSEFSFQASSVQFLNQYGFNYNKFLKNGIPYMNEEQEKKIRHDILTGNWRVRSSPDKDQIKVVIDEVTRWLELAKEGDWMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKKVSKQHRWYLQNTSCDRESCWKENILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPTKNSGPEIVHASRCEKYVETKCPHEAAYDAFLCGSVLLKVAHLLLQ

• Full Name: poly(A)-specific ribonuclease (PARN)-like domain containing 1
• Calculated Molecular Weight: 520 aa, 60 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC112246
• Gene Symbol: PNLDC1
• Gene ID (NCBI): 154197
• RRID: AB_2880131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NA58
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PNLDC1, also named as Poly(A)-specific ribonuclease PARN-like domain-containing protein 1, is a 520 amino acid protein, which belongs to the CAF1 family. PNLDC1 as a membrane protein localizes in the membrane.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
silkworm	WB	Cell; Identification and Functional Analysis of the Pre-piRNA 3' Trimmer in Silkworms.; Authors - Natsuko Izumi
human	IHC	J Ovarian Res; A risk model of gene signatures for predicting platinum response and survival in ovarian cancer.; Authors - Siyu Chen