PNLDC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PNLDC1 Polyclonal antibody (25559-1-AP)

PNLDC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25559-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, RIP, ELISA

Synonyms

PNLDC1

• 

  WB analysis using 25559-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25559-1-AP (PNLDC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 25559-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25559-1-AP (PNLDC1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 25559-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25559-1-AP (PNLDC1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PNLDC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25559-1-AP targets PNLDC1 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, silkworm
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22074

  Product name: Recombinant human PNLDC1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 19-371 aa of BC112246

  Sequence: EFTGLRSNLSGPQQISLFDLPSEWYLKTRQSVQQFTVCQIGLSVFSAIEGEANKYIAHSCNFYLFPTTFGILDSEFSFQASSVQFLNQYGFNYNKFLKNGIPYMNEEQEKKIRHDILTGNWRVRSSPDKDQIKVVIDEVTRWLELAKEGDWMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKKVSKQHRWYLQNTSCDRESCWKENILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPTKNSGPEIVHASRCEKYVETKCPHEAAYDAFLCGSVLLKVAHLLLQ

• Full Name: poly(A)-specific ribonuclease (PARN)-like domain containing 1
• Calculated Molecular Weight: 520 aa, 60 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC112246
• Gene Symbol: PNLDC1
• Gene ID (NCBI): 154197
• RRID: AB_2880131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NA58
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PNLDC1, also named as Poly(A)-specific ribonuclease PARN-like domain-containing protein 1, is a 520 amino acid protein, which belongs to the CAF1 family. PNLDC1 as a membrane protein localizes in the membrane.

Publications

What published studies show

The PNLDC1 Polyclonal antibody (Cat# 25559-1-AP) has 3 total citations. These appear in Cell, Journal of Ovarian Research, and Exploration (Beijing). The associated research fields span piRNA biology in silkworms (WB), ovarian cancer gene signature and platinum response prediction (IHC), and colorectal cancer progression involving PNLDC1-mediated mRNA decay (RIP).

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
silkworm	WB	Cell; Identification and Functional Analysis of the Pre-piRNA 3' Trimmer in Silkworms.; Authors - Natsuko Izumi
human	IHC	J Ovarian Res; A risk model of gene signatures for predicting platinum response and survival in ovarian cancer.; Authors - Siyu Chen
	RIP	Exploration (Beijing); ER-Localized Deadenylase PNLDC1 Suppresses Colorectal Cancer Progression by Targeting the mRNA Decay of TUBB4B.; Authors - Lexin Liu