PNMT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PNMT Polyclonal antibody (13217-1-AP)

PNMT Polyclonal Antibody for WB, IP, ELISA

Cat No. 13217-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

PNMTase, Phenylethanolamine N-methyltransferase, PENT, Noradrenaline N-methyltransferase, EC:2.1.1.28

• 

  WB analysis of K-562 using 13217-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13217-1-AP (PNMT antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of PC-12 using 13217-1-AP

  IP result of anti-PNMT (IP:13217-1-AP, 4ug; Detection:13217-1-AP 1:300) with PC-12 cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PNMT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IP detected in: PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13217-1-AP targets PNMT in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4098

  Product name: Recombinant human PNMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-282 aa of BC037246

  Sequence: MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL

• Full Name: phenylethanolamine N-methyltransferase
• Calculated Molecular Weight: 282 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC037246
• Gene Symbol: PNMT
• Gene ID (NCBI): 5409
• RRID: AB_2167781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11086
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phenylethanolamine N-methyltransferase(PNMT), the final enzyme in catecholamine biosynthesis, converts norepinephrine to epinephrine, thereby serving as a marker of the adrenergic phenotype.

Publications

What published studies show

The PNMT Polyclonal antibody (Cat# 13217-1-AP) has 2 total citations. These appear in Frontiers in Endocrinology and International Journal of Molecular Sciences. The cited research fields include endocrinology (adrenal medullary hyperplasia associated with hypertension) and cancer/neuroscience (neuroblastoma cell expression under intermittent hypoxia). Both citations used Western blot as the application, with reactivity in human and mouse samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Endocrinol (Lausanne); Clinical identification of expressed proteins in adrenal medullary hyperplasia detected with hypertension; Authors - He Ma
mouse	WB	Int J Mol Sci; Intermittent Hypoxia Increased the Expression of DBH and PNMT in Neuroblastoma Cells via MicroRNA-375-Mediated Mechanism.; Authors - Shin Takasawa