PNOC Polyclonal antibody

• 

PNOC Polyclonal Antibody for ELISA

Cat No. 13276-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Nociceptin, OFQ, Orphanin FQ, PNOC, PPNOC, PPNOC Neuropeptide 2, prepronociceptin

---

Published Applications

• WB: See 1 publications below

Product Information

13276-1-AP targets PNOC in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3999

  Product name: Recombinant human PNOC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-176 aa of BC034758

  Sequence: DCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV

• Full Name: prepronociceptin
• Calculated Molecular Weight: 176 aa, 20 kDa
• GenBank Accession Number: BC034758
• Gene Symbol: PNOC
• Gene ID (NCBI): 5368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13519
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Pediatr Blood Cancer; Pediatric brainstem gangliogliomas show overexpression of neuropeptide prepronociceptin (PNOC) by microarray and immunohistochemistry.; Authors - Chan Michael H MH