PNPO Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PNPO Polyclonal antibody (15552-1-AP)

PNPO Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15552-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Pyridoxine-5'-phosphate oxidase, Pyridoxine 5 phosphate oxidase, Pyridoxamine-phosphate oxidase, Pyridoxamine phosphate oxidase, PDXPO

• 

  WB analysis using 15552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15552-1-AP (PNPO antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 15552-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15552-1-AP (PNPO antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 15552-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15552-1-AP (PNPO antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 15552-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15552-1-AP (PNPO antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 15552-1-AP

  IP result of anti-PNPO (IP:15552-1-AP, 4ug; Detection:15552-1-AP 1:500) with MCF-7 cells lysate 3200 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15552-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15552-1-AP (PNPO antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 15552-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15552-1-AP (PNPO antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15552-1-AP

  Immunofluorescent analysis of Hela cells, using PNPO antibody 15552-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PNPO in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, human brain tissue, human heart tissue, human liver tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15552-1-AP targets PNPO in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7914

  Product name: Recombinant human PNPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC006525

  Sequence: MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP

• Full Name: pyridoxamine 5'-phosphate oxidase
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC006525
• Gene Symbol: PNPO
• Gene ID (NCBI): 55163
• RRID: AB_2165814
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVS9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-PNPO antibody (Cat# 15552-1-AP) has 10 total citations published in Nature Metabolism, Advanced Science, Development Cell, Apoptosis, Frontiers in Cell and Developmental Biology, Scientific Reports, Basic & Clinical Pharmacology & Toxicology, Journal of Neurodevelopmental Disorders, and bioRxiv. Research fields span hepatic metabolism, hypoxia responses, multiple myeloma, ovarian cancer, pancreatic cancer metastasis, T cell biology, and neuronal development.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Metab; PNPO-PLP axis senses prolonged hypoxia in macrophages by regulating lysosomal activity; Authors - Hiroki Sekine
mouse		Nat Metab; Spatial hepatocyte plasticity of gluconeogenesis during the metabolic transitions between fed, fasted and starvation states; Authors - Junichi Okada
mouse	WB,IHC	Adv Sci (Weinh); PNPO-Mediated Oxidation of DVL3 Promotes Multiple Myeloma Malignancy and Osteoclastogenesis by Activating the Wnt/β-Catenin Pathway; Authors - Zhendong Deng
mouse	WB	Dev Cell; Vitamin B6 preserves the stemness-like phenotypes and antitumor ability of CD8(+) T cells.; Authors - Jun Wu
mouse	IHC	Apoptosis; Targeting PNPO to suppress tumor growth via inhibiting autophagic flux and to reverse paclitaxel resistance in ovarian cancer; Authors - Xin Li
human	IHC	Front Cell Dev Biol; Prognostic Implication and Oncogenic Role of PNPO in Pan-Cancer.; Authors - Lingyun Zhang