PNRC1 Polyclonal antibody

PNRC1 Polyclonal Antibody for WB, ELISA
Cat No. 51052-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

B4 2, PNAS 145, PNRC1, PROL2, Proline rich protein 2, Protein B4 2, PRR2, RP11 63L7.5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

51052-1-AP targets PNRC1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0100

Product name: Recombinant human PNRC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 54-242 aa of BC018112

Sequence: TLFLPHFLGGDGPCLTPQPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSS

Predict reactive species
Full Name proline-rich nuclear receptor coactivator 1
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC018112
Gene Symbol PNRC1
Gene ID (NCBI) 10957
RRIDAB_2299805
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12796
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for PNRC1 antibody 51052-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Elife

YAP/TAZ enhances P-body formation to promote tumorigenesis

Authors - Xia Shen
Loading...
||
New chat Able
正在加载,请稍候...