Tested Applications
| Positive WB detected in | HCT 116 cells, HUVEC cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14929-1-AP targets POFUT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6710 Product name: Recombinant human POFUT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC000582 Sequence: MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRR Predict reactive species |
| Full Name | protein O-fucosyltransferase 1 |
| Calculated Molecular Weight | 44 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC000582 |
| Gene Symbol | POFUT1 |
| Gene ID (NCBI) | 23509 |
| RRID | AB_2166123 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H488 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein O-fucosyltransferase 1 (POFUT1) is an endoplasmic reticulum-resident glycosyltransferase that transfers O-fucose from GDP-fucose to conserved serine or threonine residues within epidermal growth factor-like (EGF) repeats of cell surface and secreted proteins, most notably the Notch receptor family. This modification is essential for Notch signaling: POFUT1-mediated O-fucosylation on Notch EGF repeats directly modulates ligand binding and is required for proper receptor trafficking and canonical signal activation, while also serving as a prerequisite for further glycan elongation by Fringe glycosyltransferases. Beyond Notch, POFUT1 fucosylates other EGF-repeat-containing substrates and functions in an endoplasmic reticulum quality control capacity, stabilizing folded EGF domains. Genetic ablation of Pofut1 in mice is embryonic lethal with phenotypes mirroring global Notch inactivation, and heterozygous mutations in human POFUT1 have been linked to Dowling-Degos disease, underscoring its physiological importance in development and tissue homeostasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for POFUT1 antibody 14929-1-AP | Download protocol |
| IHC protocol for POFUT1 antibody 14929-1-AP | Download protocol |
| IP protocol for POFUT1 antibody 14929-1-AP | Download protocol |
| WB protocol for POFUT1 antibody 14929-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The POFUT1 Polyclonal antibody (catalog no. 14929-1-AP) has 17 total citations. These appear in journals including Cell, Nature Communications, Cell Death & Disease, EBioMedicine, EMBO Molecular Medicine, Cell Proliferation, Cell & Molecular Life Sciences, Cancers, FEBS Journal, Cell Biochemistry & Function, Glycobiology, Biology of Reproduction, Biomedical Pharmacotherapy, and bioRxiv. Research fields span O-fucosylation/glycosylation, Notch signaling, cancer biology, and reproductive/placental biology.
| Species | Application | Title |
|---|---|---|
Cell In vivo CRISPR screening reveals nutrient signaling processes underpinning CD8+ T cell fate decisions.
| ||
Nat Commun Defective O-fucosylation of EDIL3 attenuates invasion and vascular remodeling of trophoblasts via LIFR signaling pathway in preeclampsia. | ||
Cell Death Dis POFUT1 promotes colorectal cancer development through the activation of Notch1 signaling.
| ||
Cell Death Dis LIF upregulates poFUT1 expression and promotes trophoblast cell migration and invasion at the fetal-maternal interface. | ||
Cell Death Dis poFUT1 promotes uterine angiogenesis and vascular remodeling via enhancing the O-fucosylation on uPA.
| ||
EBioMedicine PLAGL2 and POFUT1 are regulated by an evolutionarily conserved bidirectional promoter and are collaboratively involved in colorectal cancer by maintaining stemness.
|
Reviews
What customers say
The single review for this antibody reports a 4-star rating from use in Western Blot, Immunoprecipitation, and Immunofluorescence on pancreatic beta cells. The reviewer found the overall results to be good across all three applications, noting that the weaker signal observed in Western Blot may be attributable to the specific cell type used rather than the antibody itself. No dilution details were provided.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
fei (Verified Customer) (09-04-2025) | This antibody was used for WB, IP, and IF experiments. Overall, the results were good. The weaker signal in WB may be related to the cell type.
|
