POFUT1 Recombinant monoclonal antibody

• 

  WB analysis using 87434-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87434-1-RR (POFUT1/FUT12 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87434-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87434-1-RR against Human POFUT1 were performed. The affinity constant is 2.78 nM.

POFUT1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87434-1-RR

Clone No.252682G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.4.1.221, FUT12, GDP-fucose protein O-fucosyltransferase 1, KIAA0180, O Fuc T

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HepG2 cells, HUVEC cells, PANC-1 cells, JAR cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87434-1-RR targets POFUT1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6687

  Product name: Recombinant human POFUT1/FUT12 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-388 aa of NM_015352.2

  Sequence: GSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF

• Full Name: protein O-fucosyltransferase 1
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: NM_015352.2
• Gene Symbol: POFUT1
• Gene ID (NCBI): 23509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H488-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POFUT1 (protein O-fucosyltransferase 1), also known as GDP-fucose protein O-fucosyltransferase, is an enzyme that catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains and plays a crucial role in Notch signaling.