POLA1 Polyclonal antibody

• 

  WB analysis using 31394-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31394-1-AP (POLA1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

POLA1 Polyclonal Antibody for WB, ELISA

Cat No. 31394-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:2.7.7.7, p180, POLA

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31394-1-AP targets POLA1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35191

  Product name: Recombinant human POLA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of NM_001330360

  Sequence: MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPP

• Full Name: polymerase (DNA directed), alpha 1, catalytic subunit
• Calculated Molecular Weight: 166 kDa
• Observed Molecular Weight: 190 kDa
• GenBank Accession Number: NM_001330360
• Gene Symbol: POLA1
• Gene ID (NCBI): 5422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P09884
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.