POLD4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• POLD4 Polyclonal antibody (26209-1-AP)

POLD4 Polyclonal Antibody for WB, ELISA

Cat No. 26209-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DNA polymerase delta subunit 4, p12, POLD4, POLDS

• 

  WB analysis of A549 using 26209-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 26209-1-AP (POLD4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for POLD4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26209-1-AP targets POLD4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23924

  Product name: Recombinant human POLD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-34 aa of BC001334

  Sequence: MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

• Full Name: polymerase (DNA-directed), delta 4
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC001334
• Gene Symbol: POLD4
• Gene ID (NCBI): 57804
• RRID: AB_2880428
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCU8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The POLD4 Polyclonal antibody (Cat# 26209-1-AP) has 1 total citation. The cited publication appeared in Biomedical Research International and investigated circular RNA circ_0026359's role in enhancing cisplatin resistance in gastric cancer via the miR-1200/POLD4 pathway. The research field is gastric cancer and drug resistance. The antibody was used for Western blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biomed Res Int; Circular RNA circ_0026359 Enhances Cisplatin Resistance in Gastric Cancer via Targeting miR-1200/POLD4 Pathway.; Authors - Zongyao Zhang