POLE3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• POLE3 Polyclonal antibody (15278-1-AP)

POLE3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15278-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Arsenic transactivated protein, Arsenic-transactivated protein, AsTP, CHARAC17, CHRAC 17

• 

  WB analysis using 15278-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15278-1-AP (POLE3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 15278-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15278-1-AP (POLE3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 15278-1-AP

  IP result of anti-POLE3 (IP:15278-1-AP, 4ug; Detection:15278-1-AP 1:1000) with HepG2 cells lysate 1800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15278-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15278-1-AP (POLE3 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15278-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 15278-1-AP (POLE3 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15278-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 15278-1-AP (POLE3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for POLE3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15278-1-AP targets POLE3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7396

  Product name: Recombinant human POLE3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC003166

  Sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN

• Full Name: polymerase (DNA directed), epsilon 3 (p17 subunit)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC003166
• Gene Symbol: POLE3
• Gene ID (NCBI): 54107
• RRID: AB_2166751
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRF9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The POLE3 Polyclonal antibody (Cat# 15278-1-AP) has 4 total citations. These appear in Int J Biochem Cell Biol, Front Oncol, DNA Repair (Amst), and bioRxiv. The associated research fields include prostate cancer cell viability and EMT, oncogenesis in lung adenocarcinoma, and DNA replication mechanisms involving the nuclear structural protein NuMA.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Biochem Cell Biol; SNORA42 enhances prostate cancer cell viability, migration and EMT and is correlated with prostate cancer poor prognosis.; Authors - Chuanyou Yi
human	WB	Front Oncol; ASF1B Promotes Oncogenesis in Lung Adenocarcinoma and Other Cancer Types.; Authors - Wencheng Zhang
		DNA Repair (Amst); The nuclear structural protein NuMA is required for efficient DNA replication and supports the association of core replication factors to replication forks.; Authors - Zhen-Guo Wang
human	IF	bioRxiv; The nuclear structural protein NuMA is required for efficient DNA replication by ensuring association of core replication factors to replication forks.; Authors - Zhen-Guo Wang