POLG Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• POLG Recombinant monoclonal antibody, PBS Only (83670-1-PBS)

• 

  WB analysis using 83670-1-RR (same clone as 83670-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83670-1-RR (POLG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83670-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 83670-1-RR (same clone as 83670-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 83670-1-RR (POLG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83670-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 83670-1-RR (same clone as 83670-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 83670-1-RR (POLG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83670-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83670-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83670-1-RR against Human POLG were performed. The affinity constant is below 1 pM.

POLG Uni-rAb^® Recombinant Antibody for ELISA, WB

Cat No. 83670-1-PBS

Clone No.240441D2

Host / Isotype

Rabbit / IgG

Reactivity

rat, human

Applications

ELISA, WB

Synonyms

EC:3.1.11.-, EC:2.7.7.7, DNA polymerase subunit gamma-1, 5'-deoxyribose-phosphate lyase, 3'-5' exodeoxyribonuclease

---

Product Information

83670-1-PBS targets POLG in ELISA, WB applications and shows reactivity with rat, human samples.

• Tested Reactivity: rat, human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5256

  Product name: Recombinant human POLG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 888-1239 aa of BC042571

  Sequence: GADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP

• Full Name: polymerase (DNA directed), gamma
• Calculated Molecular Weight: 140 kDa
• GenBank Accession Number: BC042571
• Gene Symbol: POLG
• Gene ID (NCBI): 5428
• RRID: AB_3671275
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P54098
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

POLG (DNA polymerase gamma) is composed of a C-terminal polymerase ('pol') domain and an amino-terminal exonuclease ('exo') domain. The exo domain increases the fidelity of mitochondrial DNA replication by conferring a proofreading activity to the enzyme (PMID: 12210792). Catalytic subunit of POLG solely responsible for replication of mitochondrial DNA (mtDNA). Replicates both heavy and light strands of the circular mtDNA genome using a single-stranded DNA template, RNA primers and the four deoxyribonucleoside triphosphates as substrates (PMID:11477093; 11897778; 15917273; 19837034; 9558343).