Tested Applications
| Positive WB detected in | BxPC-3 cells, HEK-293 cells, Caco-2 cells, HeLa cells, HepG2 cells |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human ovary tissue, mouse liver tissue, human heart tissue, human kidney tissue, human placenta tissue, human testis tissue, human skin tissue, human liver tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15923-1-AP targets POLR1C in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8746 Product name: Recombinant human POLR1C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-346 aa of BC008863 Sequence: MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIFRNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDAVQMD Predict reactive species |
| Full Name | polymerase (RNA) I polypeptide C, 30kDa |
| Calculated Molecular Weight | 346 aa, 39 kDa |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC008863 |
| Gene Symbol | POLR1C |
| Gene ID (NCBI) | 9533 |
| RRID | AB_2167328 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15160 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
POLR1C is a DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. It is a common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for POLR1C antibody 15923-1-AP | Download protocol |
| IP protocol for POLR1C antibody 15923-1-AP | Download protocol |
| WB protocol for POLR1C antibody 15923-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The POLR1C Polyclonal antibody (Cat# 15923-1-AP) has 2 citations. One appeared in Genome Biology (2022), studying cross-regulome profiling of RNA polymerases and the role of polymerase III in maintaining local chromatin architecture in mouse. The other was published in Biochimica et Biophysica Acta – Molecular Cell Research (2025), investigating how POLR1D, a shared subunit of RNA polymerases I and III, modulates mTORC1 activity in human samples using WB. The associated research fields include transcriptional regulation, chromatin biology, and mTOR signaling.
| Species | Application | Title |
|---|---|---|
Genome Biol Cross-regulome profiling of RNA polymerases highlights the regulatory role of polymerase III on mRNA transcription by maintaining local chromatin architecture | ||
Biochim Biophys Acta Mol Cell Res POLR1D, a shared subunit of RNA polymerase I and III, modulates mTORC1 activity |
Reviews
What customers say
One user reviewed this antibody for Western Blot on HEK293T cells at a 1:1000 dilution (lot 00007242). They rated it 3/5 and reported obtaining a specific band, describing it as a "nice antibody." Overall, the single review suggests the product works as expected with clear specificity, though the moderate rating indicates room for improvement in performance or consistency.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Krishnendu (Verified Customer) (02-27-2020) | Nice antibody. Got a specific band.
|
