POLR1D Polyclonal antibody

• 

  WB analysis of Jurkat using 16678-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16678-1-AP (POLR1D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16678-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16678-1-AP (POLR1D Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16678-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16678-1-AP (POLR1D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 16678-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16678-1-AP (POLR1D antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16678-1-AP

  Immunofluorescent analysis of HepG2 cells using 16678-1-AP (POLR1D antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

POLR1D Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16678-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, RIP, ELISA

Synonyms

RPA16, POLR1C, hRPA19, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerase I subunit D

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below
• RIP: See 1 publications below

Product Information

16678-1-AP targets POLR1D in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10000

  Product name: Recombinant human POLR1D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC000889

  Sequence: MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

• Full Name: polymerase (RNA) I polypeptide D, 16kDa
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC000889
• Gene Symbol: POLR1D
• Gene ID (NCBI): 51082
• RRID: AB_2878298
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DPB6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,RIP,IF	Biochim Biophys Acta Mol Cell Res; POLR1D, a shared subunit of RNA polymerase I and III, modulates mTORC1 activity; Authors - Neuton Gorjão