POLR3C Polyclonal antibody

• 

  WB analysis using 27864-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27864-1-AP (POLR3C antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 27864-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27864-1-AP (POLR3C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

POLR3C Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27864-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

DNA-directed RNA polymerase III subunit C, DNA-directed RNA polymerase III subunit RPC3, RNA polymerase III subunit C3, RPC3, RPC62

---

Tested Applications

• Positive WB detected in: HEK-293T cells, NIH/3T3 cells, human placenta tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27864-1-AP targets POLR3C in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27311

  Product name: Recombinant human POLR3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 196-397 aa of BC002586

  Sequence: IGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLDRFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGSRCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYK

• Full Name: polymerase (RNA) III (DNA directed) polypeptide C (62kD)
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC002586
• Gene Symbol: POLR3C
• Gene ID (NCBI): 10623
• RRID: AB_3669626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUI4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mutations in the POLR3A, POLR3C, POLR3E, and POLR3F subunits are associated with susceptibility to varicella zoster virus-induced encephalitis and pneumonitis (PMID: 34395528).