POLR3G Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POLR3G Polyclonal antibody, PBS Only (24701-1-PBS)

• 

  WB analysis using 24701-1-AP (same clone as 24701-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24701-1-AP (POLR3G antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24701-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24701-1-AP (same clone as 24701-1-PBS)

  IP result of anti-POLR3G (IP:24701-1-AP, 4ug; Detection:24701-1-AP 1:3000) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 24701-1-PBS in a different storage buffer formulation.

POLR3G Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24701-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

RPC7, RPC32-alpha, RPC32, RNA polymerase III 32 kDa apha subunit, DNA-directed RNA polymerase III subunit RPC7

---

Product Information

24701-1-PBS targets POLR3G in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19872

  Product name: Recombinant human POLR3G protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-223 aa of BC141649

  Sequence: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY

• Full Name: polymerase (RNA) III (DNA directed) polypeptide G (32kD)
• Calculated Molecular Weight: 223 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC141649
• Gene Symbol: POLR3G
• Gene ID (NCBI): 10622
• RRID: AB_2879681
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15318
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

POLR3G also named as RNA polymerase III subunit C7 is a 223 amino acid protein, which belongs to eukaryotic RPC7 RNA polymerase subunit family. The molecular weight of POLR3G is 26 kDa. POLR3G localizes in the nucleus and is a component of the RNA polymerase III complex, which may be involved either in the recruitment and stablization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation.