POLR3K Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POLR3K Polyclonal antibody, PBS Only (11084-1-PBS)

• 

  IHC staining of human gliomas using 11084-1-AP (same clone as 11084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11084-1-AP (POLR3K antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11084-1-AP (same clone as 11084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11084-1-AP (same clone as 11084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11084-1-AP (same clone as 11084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11084-1-AP (same clone as 11084-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11084-1-AP (POLR3K antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11084-1-AP (same clone as 11084-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using POLR3K antibody (11084-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11084-1-AP (same clone as 11084-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 11084-1-AP (POLR3K antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11084-1-PBS in a different storage buffer formulation.

POLR3K Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 11084-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11084-1-PBS targets POLR3K in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1564

  Product name: Recombinant human POLR3K protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC011932

  Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

• Full Name: polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: BC011932
• Gene Symbol: POLR3K
• Gene ID (NCBI): 51728
• RRID: AB_2165725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2Y1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.