POLRMT Polyclonal antibody

• 

  WB analysis using 17748-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17748-1-AP (POLRMT antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 17748-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17748-1-AP (POLRMT Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 17748-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 17748-1-AP (POLRMT antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 17748-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using POLRMT antibody (17748-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

POLRMT Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17748-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MTRPOL, MTRNAP, h mtRPOL, EC:2.7.7.6, DNA-directed RNA polymerase, mitochondrial

---

Tested Applications

• Positive WB detected in: HepG2 cells, COLO 320 cells, HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

17748-1-AP targets POLRMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12012

  Product name: Recombinant human POLRMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 879-1230 aa of BC098387

  Sequence: LTGRKWWMGAEEPWQTLACCMEVANAVRASDPAAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLEGFITRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELSDFPQEFVWEASHYLVRQVFKSLQEMFSGTRAIQHWLTESARLISHMGSVVEWVTPLGVPVIQPYRLDSKVKQIGGGIQSITYTHNGDISRKPNTRKQKNGFPPNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS

• Full Name: polymerase (RNA) mitochondrial (DNA directed)
• Calculated Molecular Weight: 1230 aa, 139 kDa
• Observed Molecular Weight: 130-139 kDa
• GenBank Accession Number: BC098387
• Gene Symbol: POLRMT
• Gene ID (NCBI): 5442
• RRID: AB_3085539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00411
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial DNA-dependent RNA polymerase (POLRMT) is responsible for the transcription of mitochondrial genome encoding key components of oxidative phosphorylation. Structurally, POLRMT comprises four main domains: the N-terminal extension, a pentatricopeptide repeat (PPR) domain, the N-terminal domain, and the C-terminal domain(PMID: 33602924). POLRMT requires transcription factor B2M (TFB2M) and transcription factor AM (TFAM) for mitochondrial RNA transcription. POLRMT is overexpressed at both the mRNA and protein level in several cancers, including breast, skin, lung, endometrial cancer, and osteosarcomas(PMID: 37371693).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Mitochondria-localized MBD2c facilitates mtDNA transcription and drug resistance; Authors - Yijie Hao
human	WB	Nat Struct Mol Biol; A roadmap for ribosome assembly in human mitochondria; Authors - Elena Lavdovskaia