POMP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83607-6-RR (same clone as 83607-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83607-6-RR (POMP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83607-6-PBS in a different storage buffer formulation.

• 

  WB analysis of rat skin using 83607-6-RR (same clone as 83607-6-PBS)

  rat skin tissue were subjected to SDS PAGE followed by western blot with 83607-6-RR (POMP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83607-6-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 83607-6-RR (same clone as 83607-6-PBS)

  WB result of POMP antibody (83607-6-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-POMP transfected HepG2 cells. This data was developed using the same antibody clone with 83607-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83607-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83607-6-RR against Human POMP were performed. The affinity constant is 0.424 nM.

• Featured Product
• KD/KO Validated

POMP Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83607-6-PBS

Clone No.240563D7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

PNAS 110, hUMP1, HSPC036, HSPC014, C13orf12

---

Product Information

83607-6-PBS targets POMP in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6987

  Product name: Recombinant human POMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC003390

  Sequence: MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL

• Full Name: proteasome maturation protein
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC003390
• Gene Symbol: POMP
• Gene ID (NCBI): 51371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y244
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proteasome maturation protein(POMP), is an essential factor of mammalian proteasome biogenesis. It facilitates the main steps in 20S core complex formation at the ER to coordinate the assembly process and to provide cells with freshly formed proteasomes at their site of function. A single nucleotide deletion in this gene causes an autosomal recessive skin disorder, keratosis linearis with ichthyosis congenita and sclerosing keratoderma (KLICK) syndrome.