PON3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84604-4-RR (same clone as 84604-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84604-4-RR (PON3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84604-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 84604-4-RR (same clone as 84604-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 84604-4-RR (PON3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84604-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84604-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84604-4-RR against Human PON3 were performed. The affinity constant is below 1 pM.

PON3 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84604-4-PBS

Clone No.242035D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Paraoxonase 3 , Paraoxanase-3, EC:3.1.8.1, 242035D11

---

Product Information

84604-4-PBS targets PON3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36602

  Product name: Recombinant human PON3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-167 aa of NM_000940.2

  Sequence: AFRERVNASREVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKSVN

• Full Name: paraoxonase 3
• Calculated Molecular Weight: NM_000940.2 40kDa，354aa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_000940.2
• Gene Symbol: PON3
• Gene ID (NCBI): 5446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q15166
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PON3, a member of the paraoxonase family, is expressed primarily in the liver and encodes a protein that is secreted into the bloodstream and binds to high-density lipoprotein (HDL). It also rapidly hydrolyzes lactones and inhibits the oxidation of low-density lipoprotein (LDL), thereby slowing the onset and progression of atherosclerosis. In addition, PON3 is closely associated with hepatocellular carcinoma (HCC), and is a potential therapeutic target for HCC by inducing cell cycle arrest and further inhibiting HCC cell proliferation.