PORCN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PORCN Polyclonal antibody, PBS Only (20613-1-PBS)

• 

  WB analysis using 20613-1-AP (same clone as 20613-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20613-1-AP (PORCN antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 20613-1-AP (same clone as 20613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 20613-1-AP (PORCN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20613-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20613-1-AP (same clone as 20613-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20613-1-AP (PORCN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20613-1-PBS in a different storage buffer formulation.

PORCN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20613-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DHOF, EC:2.3.1.250, FODH, MG61, por

---

Product Information

20613-1-PBS targets PORCN in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14664

  Product name: Recombinant human PORCN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 258-348 aa of BC019080

  Sequence: EATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLGTFSAVLVTYAASALLHGFSFHLAAVLLS

• Full Name: porcupine homolog (Drosophila)
• Calculated Molecular Weight: 461 aa, 52 kDa
• Observed Molecular Weight: 43~50 kDa
• GenBank Accession Number: BC019080
• Gene Symbol: PORCN
• Gene ID (NCBI): 64840
• RRID: AB_3742002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H237
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PORCN is one of several related membrane-bound O-acyltransferase (MBOAT) enzymes encoding a 461 amino acid-sized (52 kDa) protein named porcupine located in the endoplasmic reticulum and known to be involved in the processing, secretion, and signaling of Wnt proteins (PMID: 17546031). Overexpression of PORCN could promote the proliferation and migration abilities of HCC cells both in vitro and in vivo (PMID: 37588740, 23188502).