POU3F4 Polyclonal antibody

• 

  WB analysis of fetal human brain using 25114-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 25114-1-AP (POU3F4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

POU3F4 Polyclonal Antibody for WB, ELISA

Cat No. 25114-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, ELISA

Synonyms

BRAIN 4, Brn 4, BRN4, DFN3, DFNX2, Oct 9, Octamer binding protein 9, OTF 9, OTF9, POU class 3 homeobox 4, POU3F4

---

Tested Applications

• Positive WB detected in: fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

25114-1-AP targets POU3F4 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18925

  Product name: Recombinant human POU3F4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-181 aa of BC146551

  Sequence: SILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQ

• Full Name: POU class 3 homeobox 4
• Calculated Molecular Weight: 361 aa, 39 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC146551
• Gene Symbol: POU3F4
• Gene ID (NCBI): 5456
• RRID: AB_2879903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49335
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OTF9 also named as BRN4 and POU3F4, belongs to the POU transcription factor family and Class-3 subfamily. OTF9 is a transcription factor which exerts its primary action widely during early neural development and in a very limited set of neurons in the mature brain. Mutation of OTF9 will cause of X-linked deafness type 3 (DFN3).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Biol Eng; An engineered ligand-responsive Csy4 endoribonuclease controls transgene expression from Sendai virus vectors; Authors - Takumi Kishimoto
human	WB	Cell Commun Signal; Impact of POU3F4 mutation on cochlear development and auditory function; Authors - Jiong Dang
mouse	IF	iScience; A developmental atlas of mouse vestibular-like inner ear organoids; Authors - Maggie S Matern