POU5F2 Polyclonal antibody

• 

  WB analysis of NCCIT using 26362-1-AP

  NCCIT cell were subjected to SDS PAGE followed by western blot with 26362-1-AP (POU5F2 Antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 26362-1-AP

  NCCIT cell were subjected to SDS PAGE followed by western blot with 26362-1-AP (POU5F2 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

POU5F2 Polyclonal Antibody for WB, ELISA

Cat No. 26362-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

POU5F2, SPRM 1, SPRM1

---

Tested Applications

• Positive WB detected in: NCCIT cell

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26362-1-AP targets POU5F2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23803

  Product name: Recombinant human POU5F2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC029532

  Sequence: MDGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDISGILKELQQLAKELRQKRLSLGYSQ

• Full Name: POU domain class 5, transcription factor 2
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC029532
• Gene Symbol: POU5F2
• Gene ID (NCBI): 134187
• RRID: AB_2880491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N7G0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POU5F2, also named as POU domain, class 5, transcription factor 2m, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and 1 POU-specific domain and belongs to the POU transcription factor family. POU5F2 as a transcription factor, localizes in the nuclues and may exert a regulatory function in meiotic events that are required for terminal differentiation of male germ cell.