POU6F2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POU6F2 Polyclonal antibody, PBS Only (33362-1-PBS)

• 

  WB analysis using 33362-1-AP (same clone as 33362-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33362-1-AP (POU6F2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33362-1-PBS in a different storage buffer formulation.

POU6F2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33362-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

POU domain, class 6, transcription factor 2, Retina-derived POU domain factor 1, RPF1, RPF-1

---

Product Information

33362-1-PBS targets POU6F2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38018

  Product name: Recombinant human POU6F2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001166018

  Sequence: MSALLQDPMIAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQPLLTAQ

• Full Name: POU class 6 homeobox 2
• Calculated Molecular Weight: 691aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: NM_001166018
• Gene Symbol: POU6F2
• Gene ID (NCBI): 11281
• RRID: AB_3742949
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P78424
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.