PPP2R4 Polyclonal antibody

• 

  WB analysis of HEK-293 using 10321-1-AP

  WB result of PP2A antibody (10321-1-AP, 1:600) with si-control and si-PP2A transfected HEK293 cells.

• 

  WB analysis using 10321-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10321-1-AP (PPP2R4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PPP2R4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10321-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

PP2A, PP2A, subunit B, PR53 isoform, PPP2R4, PR53, PTPA

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: mouse testis tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IP: See 1 publications below

Product Information

10321-1-AP targets PPP2R4 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0392

  Product name: Recombinant human PP2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-230 aa of BC002545

  Sequence: ILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDH

• Full Name: protein phosphatase 2A activator, regulatory subunit 4
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC002545
• Gene Symbol: PPP2R4
• Gene ID (NCBI): 5524
• RRID: AB_2284352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15257
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; KDM6B promotes PARthanatos via suppression of O6-methylguanine DNA methyltransferase repair and sustained checkpoint response.; Authors - Mingming Yang
human	WB	EBioMedicine; Cancer-associated Fibroblasts Promote Irradiated Cancer Cell Recovery Through Autophagy.; Authors - Yongbin Wang
human		J Cell Sci; The role of specific PP2A complexes in the dephosphorylation of γ-H2AX.; Authors - Liping Chen
human	WB	Mol Cancer Ther; Peptide PDHPS1 inhibits ovarian cancer growth through disrupting YAP signaling.; Authors - Xinxing Pan
human	WB	Front Immunol; CBP Bromodomain Inhibition Rescues Mice From Lethal Sepsis Through Blocking HMGB1-Mediated Inflammatory Responses.; Authors - Xiaowen Bi
human	WB	Life Sci; PP2A alleviates oxidized LDL-induced endothelial dysfunction by regulating LOX-1/ROS/MAPK axis.; Authors - Kaicheng Xu