PPP2R4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PPP2R4 Polyclonal antibody (10321-1-AP)

• Featured Product
• KD/KO Validated

PPP2R4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10321-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

PP2A, PP2A, subunit B, PR53 isoform, PPP2R4, PR53, PTPA

• 

  WB analysis of HEK-293 using 10321-1-AP

  WB result of PP2A antibody (10321-1-AP, 1:600) with si-control and si-PP2A transfected HEK293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10321-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10321-1-AP (PPP2R4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 10321-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10321-1-AP (PPP2R4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PPP2R4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: mouse testis tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10321-1-AP targets PPP2R4 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0392

  Product name: Recombinant human PP2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-230 aa of BC002545

  Sequence: ILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDH

• Full Name: protein phosphatase 2A activator, regulatory subunit 4
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC002545
• Gene Symbol: PPP2R4
• Gene ID (NCBI): 5524
• RRID: AB_2284352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15257
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-PPP2R4 (10321-1-AP) has 9 citations published in Nucleic Acids Research, EBioMedicine, International Journal of Biological Macromolecules, Frontiers in Immunology, Molecular Cancer Therapeutics, Life Sciences, Journal of Cell Science, iScience, and Experimental Cell Research. Research fields include DNA repair, cancer biology, neurodegeneration, sepsis, endothelial dysfunction, osteogenesis, and chondrocyte differentiation.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; KDM6B promotes PARthanatos via suppression of O6-methylguanine DNA methyltransferase repair and sustained checkpoint response.; Authors - Mingming Yang
human	WB	EBioMedicine; Cancer-associated Fibroblasts Promote Irradiated Cancer Cell Recovery Through Autophagy.; Authors - Yongbin Wang
rat	WB	Int J Biol Macromol; Polysaccharides from Pleurotus ostreatus alleviate cognitive impairment in a rat model of Alzheimer's disease.; Authors - Yan Zhang
human	WB	Front Immunol; CBP Bromodomain Inhibition Rescues Mice From Lethal Sepsis Through Blocking HMGB1-Mediated Inflammatory Responses.; Authors - Xiaowen Bi
human	WB	Mol Cancer Ther; Peptide PDHPS1 inhibits ovarian cancer growth through disrupting YAP signaling.; Authors - Xinxing Pan
human	WB	Life Sci; PP2A alleviates oxidized LDL-induced endothelial dysfunction by regulating LOX-1/ROS/MAPK axis.; Authors - Kaicheng Xu