PPA1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85445-3-RR (same clone as 85445-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85445-3-RR (PPA1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85445-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85445-3-RR (same clone as 85445-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85445-3-RR (PPA1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85445-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85445-3-RR (same clone as 85445-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85445-3-RR (PPA1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85445-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85445-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85445-3-RR against Human PPA1 were performed. The affinity constant is 4.07 nM.

PPA1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85445-3-PBS

Clone No.242963D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242963D1, EC:3.6.1.1, Inorganic pyrophosphatase, IOPPP, PP

---

Product Information

85445-3-PBS targets PPA1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6969

  Product name: Recombinant human PPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC001022

  Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

• Full Name: pyrophosphatase (inorganic) 1
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC001022
• Gene Symbol: PPA1
• Gene ID (NCBI): 5464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15181
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPA1(Inorganic pyrophosphatase) is also named as IOPPP, PP and PPase. It maintains the thermodynamic favorability of these reactions by catalyzing the hydrolysis of pyrophosphates into organic phosphates, which are then exported across the cell membrane(PMID:16300924).The erythrocyte inorganic pyrophosphatase molecule would appear to be a dimer(PMID:4130389).