PPAN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PPAN Polyclonal antibody (11006-1-AP)

• Featured Product
• KD/KO Validated

PPAN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11006-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

BXDC3, Peter Pan homolog, peter pan homolog (Drosophila), PPAN, SSF, Ssf 1, SSF1, SSF2, Suppressor of SWI4 1 homolog

• 

  WB analysis using 11006-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11006-1-AP (PPAN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 11006-1-AP

  WB result of PPAN antibody (11006-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PPAN transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 11006-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 11006-1-AP (PPAN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PPAN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue, rat liver tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11006-1-AP targets PPAN in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, xenopus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1419

  Product name: Recombinant human PPAN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 174-473 aa of BC009833

  Sequence: LNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA

• Full Name: peter pan homolog (Drosophila)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC009833
• Gene Symbol: PPAN
• Gene ID (NCBI): 56342
• RRID: AB_2168040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ55
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPAN (or SSF, SSF1 or SSF2) gene is widely expressed, and encodes peter pan homolog protein which may be localized in nucleus. Two isoforms are produced through alternative splicing. So far the characterization of this protein is largely unknown, multiple phosphorylation sites has been revealed based on high-throughput phosphorylation analysis. This antibody is raised against the C-terminal of huaman PPAN and recognize bands around 55 kDa.

Publications

What published studies show

The anti-Peter Pan (PPAN) antibody (Cat# 11006-1-AP) has 8 total citations published in journals including Molecular Cell, EMBO Journal, Cells, Cancers, Biochimica et Biophysica Acta, Journal of Biological Chemistry, Development, and Biology of the Cell. Research fields span nucleolar stress, autophagy, ribosome biogenesis, cell cycle regulation, apoptosis, Wnt signaling, neurogenesis, and embryonic development in human, mouse, and Xenopus models.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Mol Cell; Granular component sub-phases direct ribosome biogenesis in the nucleolus.; Authors - Priyanka Dogra
mouse	IP	EMBO J; The long non-coding RNA Paupar promotes KAP1-dependent chromatin changes and regulates olfactory bulb neurogenesis.; Authors - Ioanna Pavlaki
human	WB	Cells; Loss of Peter Pan (PPAN) Affects Mitochondrial Homeostasis and Autophagic Flux.; Authors - David P Dannheisig ; KD Validated
human	WB	Cancers (Basel); Nucleolar Stress Functions Upstream to Stimulate Expression of Autophagy Regulators.; Authors - David P Dannheisig ; KD Validated
human	WB	Biochim Biophys Acta Mol Cell Res; Loss of Peter Pan protein is associated with cell cycle defects and apoptotic events.; Authors - Marina Keil ; KD Validated
human	WB, IF	J Biol Chem; The Wnt target Peter Pan defines a novel p53-independent nucleolar stress response pathway.; Authors - Astrid S Pfister ; KD Validated