Tested Applications
| Positive WB detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10451-1-AP targets PPAP2C in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0660 Product name: Recombinant human PPAP2C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC002806 Sequence: MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLG Predict reactive species |
| Full Name | phosphatidic acid phosphatase type 2C |
| Calculated Molecular Weight | 32 kDa |
| GenBank Accession Number | BC002806 |
| Gene Symbol | PPAP2C |
| Gene ID (NCBI) | 8612 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43688 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPAP2C(phosphatidic acid phosphatase type 2C) is also named as PAP2C, LPP2, PAP-2c, PAP2-g. PPAP2C is a member of the phosphatidic acid phosphatase family of enzymes that regulate the dephosphorylation of lipid phosphates and the gene appears to be particularly highly expressed in breast carcinoma, dedifferentiated chondrosarcoma, fibromatosis, synovial sarcoma, and neurofibroma(PMID:19139135). It has 2 isoforms produced by alternative splicing and the full length protein has a glycosylation site.
Publications
What published studies show
The PPAP2C Polyclonal antibody (Cat# 10451-1-AP) has 1 citation. It appears in Translational Oncology, in a study on single-cell landscape analysis revealing PLPP2 upregulation underlying radiotherapy resistance and immune microenvironment remodeling in pancreatic cancer. The research field is oncology, specifically pancreatic cancer and radiotherapy resistance mechanisms.
| Species | Application | Title |
|---|---|---|
Transl Oncol Single-cell landscape reveals PLPP2 upregulation underlying radiotherapy resistance and immune microenvironment remodeling in pancreatic cancer.
|
