PPARGC1B Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PPARGC1B Monoclonal antibody (67821-1-Ig)

PPARGC1B Monoclonal Antibody for WB, ELISA

Cat No. 67821-1-Ig Copied!

Clone No. 2D2E8

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig, rat

Applications

WB, ELISA

Synonyms

ERRL1, PERC, PGC 1 beta, PGC 1(beta), PGC1, PGC1B, PPAR gamma coactivator 1 beta, PPARGC 1 beta, PPARGC1, PPARGC1B

• 

  WB analysis using 67821-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 67821-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig brain using 67821-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 67821-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 67821-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67821-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 67821-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67821-1-Ig (PPARGC1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PPARGC1B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, SH-SY5Y cells, pig brain tissue, rat brain tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67821-1-Ig targets PPARGC1B in WB, ELISA applications and shows reactivity with Human, mouse, pig, rat samples.

• Tested Reactivity: Human, mouse, pig, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28861

  Product name: Recombinant human PPARGC1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC132971

  Sequence: MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD

• Full Name: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• Calculated Molecular Weight: 1023 aa, 113 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC132971
• Gene Symbol: PPARGC1B
• Gene ID (NCBI): 133522
• RRID: AB_2918584
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86YN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The PPARGC1B Monoclonal antibody (2D2E8), catalog number 67821-1-Ig, has a total of 2 citations. These citations appear in Chemical & Biological Interactions and Scientific Reports. The associated research fields include cadmium-induced kidney injury and sirtuin 1-P53 signaling pathway activation, as well as dietary oleic acid effects on skeletal muscle fiber type composition. Both studies utilized the antibody for Western blot applications in rat and mouse models, respectively.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Chem Biol Interact; N-acetylcysteine delayed cadmium-induced chronic kidney injury by activating the sirtuin 1-P53 signaling pathway; Authors - Wenxuan Dong
mouse	WB	Sci Rep; Dietary oleic acid intake increases the proportion of type 1 and 2X muscle fibers in mice; Authors - Yusuke Komiya