PPAT Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85096-1-RR (same clone as 85096-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85096-1-RR (PPAT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85096-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85096-1-RR against Human PPAT were performed. The affinity constant is 9.40 nM.

PPAT Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85096-1-PBS

Clone No.242513C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

PRAT, phosphoribosyl pyrophosphate amidotransferase, GPAT, EC:2.4.2.14, 242513C4

---

Product Information

85096-1-PBS targets PPAT in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7618

  Product name: Recombinant human PPAT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 178-517 aa of BC004200

  Sequence: KEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW

• Full Name: phosphoribosyl pyrophosphate amidotransferase
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC004200
• Gene Symbol: PPAT
• Gene ID (NCBI): 5471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q06203
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPAT, also known as ATase (amidophosphoribosyltransferase) or GPAT (glutamine phosphoribosylpyrophosphate amidotransferase) is the rate-limiting enzyme in the de novo pathway of purine ribonucleotide synthesis and is regulated by feedback inhibition by AMP and GMP. PPAT expression modulates pyruvate kinase activity, cell proliferation and invasion (PMID: 26140362).