Home
Products
Primary Antibodies
Recombinant Antibodies
PPAT Recombinant monoclonal antibody, PBS Only (85096-1-PBS)

PPAT Recombinant monoclonal antibody, PBS Only

Name: PPAT Recombinant monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 85096-1-PBS-100UG

PPAT Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85096-1-PBS

Clone No. 242513C4

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242513C4, EC:2.4.2.14, GPAT, phosphoribosyl pyrophosphate amidotransferase, PRAT

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCAffinity

WB analysis using 85096-1-RR (same clone as 85096-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 85096-1-RR (PPAT antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 85096-1-RR (same clone as 85096-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85096-1-RR (PPAT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 85096-1-RR (same clone as 85096-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 85096-1-RR (PPAT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse colon using 85096-1-RR (same clone as 85096-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 85096-1-RR (PPAT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat brain using 85096-1-RR (same clone as 85096-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 85096-1-RR (PPAT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 85096-1-RR (same clone as 85096-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 85096-1-RR (PPAT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 85096-1-RR (same clone as 85096-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85096-1-RR (PPAT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85096-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 85096-1-RR
Biolayer interferometry (BLl) kinetic assays of 85096-1-RR against Human PPAT were performed. The affinity constant is 9.40 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PPAT in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

85096-1-PBS targets PPAT in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag7618 Product name: Recombinant human PPAT protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 178-517 aa of BC004200 Sequence: KEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW Predict reactive species
Full Name	phosphoribosyl pyrophosphate amidotransferase
Calculated Molecular Weight	57 kDa
Observed Molecular Weight	57 kDa
GenBank Accession Number	BC004200
Gene Symbol	PPAT
Gene ID (NCBI)	5471
RRID	AB_3744008
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q06203
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PPAT, also known as ATase (amidophosphoribosyltransferase) or GPAT (glutamine phosphoribosylpyrophosphate amidotransferase) is the rate-limiting enzyme in the de novo pathway of purine ribonucleotide synthesis and is regulated by feedback inhibition by AMP and GMP. PPAT expression modulates pyruvate kinase activity, cell proliferation and invasion (PMID: 26140362).