PPFIA3 Polyclonal antibody

• 

  WB analysis using 11492-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11492-1-AP (PPFIA3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 11492-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11492-1-AP (PPFIA3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 11492-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11492-1-AP (PPFIA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 11492-1-AP

  IP result of anti-PPFIA3 (IP:11492-1-AP, 4ug; Detection:11492-1-AP 1:600) with mouse brain tissue lysate 3440ug.

• 

  IHC staining of mouse cerebellum using 11492-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 11492-1-AP (PPFIA3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 11492-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 11492-1-AP (PPFIA3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PPFIA3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11492-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

PTPRF-interacting protein alpha-3, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3, Liprin-alpha-3, KIAA0654

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HEK-293 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

11492-1-AP targets PPFIA3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1971

  Product name: Recombinant human PPFIA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC021255

  Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

• Full Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
• Calculated Molecular Weight: 1194 aa, 133 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC021255
• Gene Symbol: PPFIA3
• Gene ID (NCBI): 8541
• RRID: AB_2171628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75145
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; miR-99 family of MicroRNAs suppresses the expression of prostate-specific antigen and prostate cancer cell proliferation.; Authors - Sun Dandan D
		Open Biol; The structural basis of the talin-KANK1 interaction that coordinates the actin and microtubule cytoskeletons at focal adhesions; Authors - Xingchen Li
mouse	IHC	Cell Rep; Neurexins play a crucial role in cerebellar granule cell survival by organizing autocrine machinery for neurotrophins.; Authors - Takeshi Uemura