PPFIA3 Recombinant monoclonal antibody, PBS Only (Detector)

PPFIA3 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83142-3-PBS
Clone No.230459B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

KIAA0654, Liprin-alpha-3, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3, PTPRF-interacting protein alpha-3

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83142-3-PBS targets PPFIA3 as part of a matched antibody pair:

MP00170-1: 83142-1-PBS capture and 83142-3-PBS detection (validated in Cytometric bead array)

MP00170-2: 83142-4-PBS capture and 83142-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1971

Product name: Recombinant human PPFIA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC021255

Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Calculated Molecular Weight 1194 aa, 133 kDa
GenBank Accession NumberBC021255
Gene Symbol PPFIA3
Gene ID (NCBI) 8541
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75145
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...