Cyclophilin E Polyclonal antibody

Cyclophilin E Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 15357-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PPIE, Cyclophilin 33, Cyclophilin-33, CYP 33, CYP33

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBxPC-3 cells, HeLa cells, Jurkat cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15357-1-AP targets Cyclophilin E in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7603

Product name: Recombinant human PPIE protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-301 aa of BC004898

Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Predict reactive species
Full Name peptidylprolyl isomerase E (cyclophilin E)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 33-38 kDa
GenBank Accession NumberBC004898
Gene Symbol Cyclophilin E
Gene ID (NCBI) 10450
RRIDAB_2878131
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UNP9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin E (CypE), also known as Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily (PMID: 15998457). Cyclophilin E negatively regulates influenza virus replication and transcription occurs by impairing the formation of the vRNP (PMID: 21887220). Additionally, Cyclophilin E plays an important role in osteoblast differentiation as a positive regulator by increasing the transcriptional activity of Runx2 (PMID: 37947627).

Protocols

Product Specific Protocols
IF protocol for Cyclophilin E antibody 15357-1-APDownload protocol
IHC protocol for Cyclophilin E antibody 15357-1-APDownload protocol
WB protocol for Cyclophilin E antibody 15357-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (07-19-2025)

Overall antibody recognize the band of the expected size, but there are several non-specific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: RKO
Cyclophilin E Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:15357-1-AP)
FH

Moritz (Verified Customer) (09-12-2024)

Several bands were observable in WB, also the expected size of PPIE, although it was not the strongest.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T
Cyclophilin E Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:15357-1-AP)
FH

Tsimafei (Verified Customer) (08-12-2024)

Multiple bands are present, however the one corresponding to Cyclophilin E size (~33 kDa) is clearly visible

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mESCs
Cyclophilin E Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:15357-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...