Cyclophilin E Polyclonal antibody

• 

  WB analysis using 15357-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15357-1-AP (Cyclophilin E antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15357-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15357-1-AP (Cyclophilin E antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 15357-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Cyclophilin E antibody (15357-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

Cyclophilin E Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15357-1-AP

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

PPIE, Cyclophilin 33, Cyclophilin-33, CYP 33, CYP33

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HeLa cells, Jurkat cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15357-1-AP targets Cyclophilin E in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7603

  Product name: Recombinant human PPIE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-301 aa of BC004898

  Sequence: MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

• Full Name: peptidylprolyl isomerase E (cyclophilin E)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33-38 kDa
• GenBank Accession Number: BC004898
• Gene Symbol: Cyclophilin E
• Gene ID (NCBI): 10450
• RRID: AB_2878131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNP9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin E (CypE), also known as Cyclophilin-33, Rotamase E, CYP33, PPIE, is an enzyme which belongs to the cyclophilin-type PPIase family of PPIase E subfamily (PMID: 15998457). Cyclophilin E negatively regulates influenza virus replication and transcription occurs by impairing the formation of the vRNP (PMID: 21887220). Additionally, Cyclophilin E plays an important role in osteoblast differentiation as a positive regulator by increasing the transcriptional activity of Runx2 (PMID: 37947627).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Aleksandr (Verified Customer) (07-19-2025)

Overall antibody recognize the band of the expected size, but there are several non-specific bands

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: RKO

Cyclophilin E Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:15357-1-AP)

FH

Moritz (Verified Customer) (09-12-2024)

Several bands were observable in WB, also the expected size of PPIE, although it was not the strongest.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HEK293T

Cyclophilin E Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:15357-1-AP)

FH

Tsimafei (Verified Customer) (08-12-2024)

Multiple bands are present, however the one corresponding to Cyclophilin E size (~33 kDa) is clearly visible

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: mESCs

Cyclophilin E Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:15357-1-AP)