PPM1J Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPM1J Polyclonal antibody, PBS Only (16269-1-PBS)

• 

  WB analysis using 16269-1-AP (same clone as 16269-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16269-1-AP (PPM1J antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16269-1-PBS in a different storage buffer formulation.

PPM1J Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16269-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

16269-1-PBS targets PPM1J in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9336

  Product name: Recombinant human PPM1J protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 262-488 aa of BC011803

  Sequence: DSRAIIVRNGEIIPMSREFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARVMATIGVTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCEVAATVDRVLSAYEPNDHSRYTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS

• Full Name: protein phosphatase 1J (PP2C domain containing)
• Calculated Molecular Weight: 505 aa, 54 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC011803
• Gene Symbol: PPM1J
• Gene ID (NCBI): 333926
• RRID: AB_3669235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JR12
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPM1J also known as PPP2CZ, PP2C-zeta, belongs to the PP2C family. It has a unique N-terminal region and a proline-rich domain between conserved motifs II and III.