PDP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDP1 Polyclonal antibody (21176-1-AP)

• Featured Product
• KD/KO Validated

PDP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 21176-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

PPM2C, [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, EC:3.1.3.43, PDP 1, PDPC 1

• 

  WB analysis of PC-3 using 21176-1-AP

  WB result of PDP1 antibody (21176-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PDP1 transfected PC-3 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21176-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21176-1-AP (PPM2C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 21176-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21176-1-AP (PPM2C Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 21176-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 21176-1-AP (PPM2C Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 21176-1-AP

  IP result of anti-PDP1 (IP:21176-1-AP, 4ug; Detection:21176-1-AP 1:300) with mouse brain tissue lysate 5200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 21176-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 21176-1-AP (PPM2C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 21176-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 21176-1-AP (PPM2C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 21176-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 21176-1-AP (PPM2C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 21176-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 21176-1-AP (PPM2C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: PC-3 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse heart tissue, mouse liver tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human prostate cancer tissue, human thyroid cancer tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21176-1-AP targets PDP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15453

  Product name: Recombinant human PPM2C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC047619

  Sequence: MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQA

• Full Name: protein phosphatase 2C, magnesium-dependent, catalytic subunit
• Calculated Molecular Weight: 537 aa, 61 kDa
• Observed Molecular Weight: 55-61 kDa
• GenBank Accession Number: BC047619
• Gene Symbol: PDP1
• Gene ID (NCBI): 54704
• RRID: AB_2878824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0J1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pyruvate dehydrogenase phosphatase 1 (PDP1) is a key hormone-regulated metabolic enzyme that dephosphorylates and activates pyruvate dehydrogenase (PDH), thereby stimulating the conversion of pyruvate into acetyl-CoA (PMID: 36453802). PDP1 expression is regulated by FLT3-ITD in a context-dependent manner, and that it is centrally involved in the adaptation of AML glucose metabolism to the requirements of proliferation, survival and the therapeutic response to FLT3 inhibition (PMID: 37935978).

Publications

What published studies show

Anti-PDP1 antibody (Cat# 21176-1-AP) has 9 total citations published in journals including Cancer Discovery, Cell Death & Disease, Aging, Frontiers in Pharmacology, The Journal of Physiology, ACS Chemical Neuroscience, Journal of Diabetes Research, Cell Biochemistry and Function, and Current Medical Science. Research fields span cancer biology (renal cell carcinoma, colorectal cancer, breast cancer), metabolic remodeling, ferroptosis, neuroinflammation, stroke, diabetes, and immune signaling.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Discov; Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma; Authors - Megan E Bischoff
human	WB	Cell Death Dis; Mitochondrial dysfunction induces radioresistance in colorectal cancer by activating [Ca2+]m-PDP1-PDH-histone acetylation retrograde signaling.; Authors - Yingying Shi
human	IHC	Aging (Albany NY); Identification of immune-related cells and genes in the breast invasive carcinoma microenvironment.; Authors - Xingfeng Chen
human	WB	Front Pharmacol; PDP1 related ferroptosis risk signature indicates distinct immune microenvironment and prognosis of breast cancer patients; Authors - Yufeng Wang ; KD Validated
mouse	WB	J Physiol; Monocarboxylate transporter 4 deficiency enhances high-intensity interval training-induced metabolic adaptations in skeletal muscle; Authors - Yuki Tamura
mouse	WB	ACS Chem Neurosci; FDCA Attenuates Neuroinflammation and Brain Injury after Cerebral Ischemic Stroke; Authors - Xin Guan