PPP1CB Polyclonal antibody

PPP1CB Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 10140-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Serine/threonine-protein phosphatase PP1-beta catalytic subunit, PPP1CD, PP-1B, PP1 Beta, PP 1B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue, NIH/3T3
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman cervical cancer tissue, human ovary tumor tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10140-2-AP targets PPP1CB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0183

Product name: Recombinant human PPP1CB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-183 aa of BC002697

Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME

Predict reactive species
Full Name protein phosphatase 1, catalytic subunit, beta isoform
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC002697
Gene Symbol PPP1CB
Gene ID (NCBI) 5500
RRIDAB_2168272
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62140
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein phosphatase 1 (PP1) is the main eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular processes including protein-protein interactions, gene transcription, cell-cycle progression and apoptosis. It is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. The catalytic subunit of PP1 (PP1c) can interact with amount of regulatory subunits in vivo that target it to particular subcellular locations and regulate its activity towards specific substrates. PPP1CB migrated as a 37kd protein on SDS page. This antibody is specific to PPP1CB.

Protocols

Product Specific Protocols
IHC protocol for PPP1CB antibody 10140-2-APDownload protocol
IP protocol for PPP1CB antibody 10140-2-APDownload protocol
WB protocol for PPP1CB antibody 10140-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Am J Physiol Cell Physiol

PP1γ functionally augments the alternative splicing of CaMKIIδ through interacting with ASF.

Authors - Chao Huang
humanWB,IHC

Melanoma Res

Differential expression patterns of capping protein, protein phosphatase 1, and casein kinase 1 may serve as diagnostic markers for malignant melanoma.

Authors - Sun Daxin D
ratWB, IP

Clin Exp Pharmacol Physiol

Rescue of cardiac failing and remodeling by inhibition of PP1γ is associated with suppression of the ASF-mediated splicing of CaMKIIδ

Authors - Ru-Jia Liao
humanWB

Adv Sci (Weinh)

Histones Methyltransferase NSD3 Inhibits Lung Adenocarcinoma Glycolysis Through Interacting with PPP1CB to Decrease STAT3 Signaling Pathway

Authors - Yanling Zhou
humanIF

J Exp Clin Cancer Res

Non-canonical activation of MAPK signaling by the lncRNA ASH1L-AS1-encoded microprotein APPLE through inhibition of PP1/PP2A-mediated ERK1/2 dephosphorylation in hepatocellular carcinoma

Authors - Lei Zhao
humanWB

Comput Struct Biotechnol J

Alternative polyadenylation regulates the translation of metabolic and inflammation-related proteins in adipose tissue of gestational diabetes mellitus

Authors - Bingnan Chen
Loading...
||
New chat Able
正在加载,请稍候...