Tested Applications
| Positive WB detected in | human brain tissue, NIH/3T3 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human cervical cancer tissue, human ovary tumor tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10140-2-AP targets PPP1CB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0183 Product name: Recombinant human PPP1CB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC002697 Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME Predict reactive species |
| Full Name | protein phosphatase 1, catalytic subunit, beta isoform |
| Calculated Molecular Weight | 37 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC002697 |
| Gene Symbol | PPP1CB |
| Gene ID (NCBI) | 5500 |
| RRID | AB_2168272 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62140 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein phosphatase 1 (PP1) is the main eukaryotic protein serine/threonine phosphatase that regulates an enormous variety of cellular processes including protein-protein interactions, gene transcription, cell-cycle progression and apoptosis. It is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. The catalytic subunit of PP1 (PP1c) can interact with amount of regulatory subunits in vivo that target it to particular subcellular locations and regulate its activity towards specific substrates. PPP1CB migrated as a 37kd protein on SDS page. This antibody is specific to PPP1CB.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PPP1CB antibody 10140-2-AP | Download protocol |
| IP protocol for PPP1CB antibody 10140-2-AP | Download protocol |
| WB protocol for PPP1CB antibody 10140-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PPP1CB Polyclonal antibody (Cat# 10140-2-AP) has 10 citations published in journals including J Exp Clin Cancer Res, Adv Sci, J Immunother Cancer, Phytomedicine, Am J Physiol Cell Physiol, Biol Proced Online, Comput Struct Biotechnol J, Clin Exp Pharmacol Physiol, Physiol Rep, and Melanoma Res. Research fields span hepatocellular carcinoma, lung adenocarcinoma, multiple myeloma, metabolic liver disease, cardiac remodeling, prostate cancer, gestational diabetes, placental biology, and melanoma.
| Species | Application | Title |
|---|---|---|
J Exp Clin Cancer Res Non-canonical activation of MAPK signaling by the lncRNA ASH1L-AS1-encoded microprotein APPLE through inhibition of PP1/PP2A-mediated ERK1/2 dephosphorylation in hepatocellular carcinoma | ||
Adv Sci (Weinh) Histones Methyltransferase NSD3 Inhibits Lung Adenocarcinoma Glycolysis Through Interacting with PPP1CB to Decrease STAT3 Signaling Pathway | ||
J Immunother Cancer Dexamethasone activates anti-tumor immunity in multiple myeloma by dismantling the GR-PPP1CB complex to restore STING/IRF3 signaling. | ||
Phytomedicine Obacunone ameliorates high-fat diet-induced MAFLD by regulating the PPARγ-FABP1/CD36 axis and the gut-liver crosstalk | ||
Am J Physiol Cell Physiol PP1γ functionally augments the alternative splicing of CaMKIIδ through interacting with ASF. | ||
Biol Proced Online Lipid Metabolic Rewiring During Continuous Prostate Cancer Progression Defines a Biologically Relevant Four-Gene Prognostic Signature. |
