PPP1CB Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84938-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 84938-1-PBS against Human PPP1CB was performed. The affinity constant is 12.0 nM.

PPP1CB Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84938-1-PBS

Clone No.242547A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

EC:3.1.3.16, PP 1B, PP1 Beta, PP-1B, PPP1CD

---

Product Information

84938-1-PBS targets PPP1CB in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0183

  Product name: Recombinant human PPP1CB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC002697

  Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME

• Full Name: protein phosphatase 1, catalytic subunit, beta isoform
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC002697
• Gene Symbol: PPP1CB
• Gene ID (NCBI): 5500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62140
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.