PPP1CC Polyclonal antibody

• 

  WB analysis using 30070-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30070-1-AP (PPP1CC antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 30070-1-AP

  WB result of PPP1CC antibody (30070-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PPP1CC transfected HEK-293 cells.

• 

  IHC staining of mouse heart using 30070-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 30070-1-AP (PPP1CC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 30070-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 30070-1-AP (PPP1CC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 30070-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PPP1CC antibody (30070-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

PPP1CC Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30070-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:3.1.3.16, PP-1G, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30070-1-AP targets PPP1CC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32348

  Product name: Recombinant human PPP1CC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 206-323 aa of BC014073

  Sequence: WSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

• Full Name: protein phosphatase 1, catalytic subunit, gamma isoform
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC014073
• Gene Symbol: PPP1CC
• Gene ID (NCBI): 5501
• RRID: AB_3086223
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36873
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.