PPP1R12B Polyclonal antibody

• 

  WB analysis using 13366-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13366-1-AP (PPP1R12B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 13366-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13366-1-AP (PPP1R12B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 13366-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13366-1-AP (PPP1R12B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 13366-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13366-1-AP (PPP1R12B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 13366-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using 13366-1-AP (PPP1R12B antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

PPP1R12B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13366-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MYPT2, Myosin phosphatase-targeting subunit 2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

13366-1-AP targets PPP1R12B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4185

  Product name: Recombinant human PPP1R12B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-386 aa of BC034430

  Sequence: MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 12B
• Calculated Molecular Weight: 982 aa, 110 kDa
• Observed Molecular Weight: 110 kDa
• GenBank Accession Number: BC034430
• Gene Symbol: PPP1R12B
• Gene ID (NCBI): 4660
• RRID: AB_2168445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60237
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IF	EBioMedicine; Epistatic evidence for gender-dependant slow neurotransmission signalling in substance use disorders: PPP1R12B versus PPP1R1B.; Authors - Kefu Liu
mouse	WB	Skelet Muscle; Novel γ-sarcoglycan interactors in murine muscle membranes.; Authors - Tara C Smith
mouse	IF	J Biol Chem; The MYPT2-regulated striated muscle-specific myosin light chain phosphatase limits cardiac myosin phosphorylation in vivo; Authors - Eunyoung Lee

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Shalini (Verified Customer) (08-13-2025)

Works nice in mammalian cells whole cell lysates

• Applications: Immunoprecipitation
• Cell Tissue Type: U2OS, Hela