Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

iASPP Polyclonal antibody

iASPP Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

PPP1R13L, PPP1R13B-like protein, PPP1R13BL, PPP1R13B like protein, NKIP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for iASPP in ?

Tested Applications

Positive WB detected inNIH/3T3 cells, PC-3 cells, MCF-7 cells, Apoptosised HeLa cells, C6 cells
Positive IP detected inPC-3 cells
Positive IHC detected inhuman breast cancer tissue, human cervical squamous cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18590-1-AP targets iASPP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13273

Product name: Recombinant human PPP1R13L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 481-829 aa of BC064913

Sequence: EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV

Predict reactive species
Full Name protein phosphatase 1, regulatory (inhibitor) subunit 13 like
Calculated Molecular Weight 89 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC064913
Gene Symbol PPP1R13L
Gene ID (NCBI) 10848
RRIDAB_2168573
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WUF5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Inhibitor of apoptosis-stimulating protein of p53 (iASPP), encoded by PPP1R13L gene, is often overexpressed in human cancers. The ASPP family includes three members, namely ASPP1, ASPP2, and iASPP, which are specific regulators of p53-, p63-, and p73-mediated apoptosis. ASPP1 and ASPP2 enhance the apoptotic function of p53, whereas iASPP specifically inhibits p53-mediated apoptosis. Overexpression of iASPP is associated with resistance to cisplatin-induced apoptosis and rediation therapy. iASPP plays a pivotal role in regulating cancer cell proliferation and tumor progression. This antibody could both recognize unphosphorylated and phosphorylated iASPP.

Protocols

Product Specific Protocols
IF protocol for iASPP antibody 18590-1-APDownload protocol
IHC protocol for iASPP antibody 18590-1-APDownload protocol
IP protocol for iASPP antibody 18590-1-APDownload protocol
WB protocol for iASPP antibody 18590-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The iASPP (PPP1R13L) antibody (Cat# 18590-1-AP) has 8 citations across journals including Advanced Science, Cell Death & Disease, Antioxidants, Journal of Cell Biology, Acta Biochimica et Biophysica Sinica, Metabolic Brain Diseases, and Journal of Biochemical and Molecular Toxicology. Research fields span lung carcinogenesis, cytokinetic abscission, acute myeloid leukemia, oxidative stress and apoptosis, mitotic cell mechanics, cardiac ischemia protection, dopaminergic neurotoxicity, and hypoxia/reoxygenation injury.

SpeciesApplicationTitle
humanWB,CoIP

Adv Sci (Weinh)

A Unique Chimeric RNA: ERCC1-iASPP Drives Benzo[a]pyrene-Induced Lung Carcinogenesis via Dual Coding and Non-Coding Mechanisms.

Authors - Mingming Shan
human

Cell Death Dis

High iASPP (PPP1R13L) expression is an independent predictor of adverse clinical outcome in acute myeloid leukemia (AML)

Authors - Mihada Bajrami Saipi
humanWB,IP,IF

Cell Death Dis

iASPP-PP1 complex is required for cytokinetic abscission by controlling CEP55 dephosphorylation.

Authors - Kun Gao
  • KD Validated
pigWB

Antioxidants (Basel)

Apigenin Alleviates Zearalenone-Induced Oxidative Stress and Apoptosis in Swine Testis Cells Through the Wnt Signaling Pathway.

Authors - Chenyun Guo
humanWB,IP

J Cell Biol

iASPP contributes to cell cortex rigidity, mitotic cell rounding, and spindle positioning.

Authors - Aurélie Mangon
  • KD Validated
mouseWB

Acta Biochim Biophys Sin (Shanghai)

iASPP protects the heart from ischemia injury by inhibiting p53 expression and cardiomyocyte apoptosis.

Authors - Timur Yagudin
Loading...
||
New chat

Able™

正在加载,请稍候...