PPP2CA Monoclonal antibody, PBS Only

• 

  WB analysis using 67809-1-Ig (same clone as 67809-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67809-1-Ig (PPP2CA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67809-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67809-1-Ig (same clone as 67809-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67809-1-Ig (PPP2CA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67809-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67809-1-Ig (same clone as 67809-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67809-1-Ig (PPP2CA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67809-1-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 67809-1-PBS

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug PPP2CA Monoclonal antibody, PBS Only (67809-1-PBS, Clone:3A6H5) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

PPP2CA Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67809-1-PBS

Clone No.3A6H5

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

3A6H5, EC:3.1.3.16, PP2A alpha, PP2A-alpha, PP2Ac

---

Tested Applications

• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

67809-1-PBS targets PPP2CA in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4294

  Product name: Recombinant human PPP2CA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-309 aa of BC031696

  Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

• Full Name: protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
• Calculated Molecular Weight: 309 aa, 36 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC031696
• Gene Symbol: PPP2CA
• Gene ID (NCBI): 5515
• RRID: AB_2918572
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P67775
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.