PPP2CB Polyclonal antibody

• 

  WB analysis of mouse lung using 12554-2-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 12554-2-AP (PPP2CB antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 12554-2-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 12554-2-AP (PPP2CB Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of NIH/3T3 using 12554-2-AP

  IP result of anti-PPP2CB (IP:12554-2-AP, 4ug; Detection:12554-2-AP 1:300) with NIH/3T3 cells lysate 4000ug.

• 

  IHC staining of human stomach cancer using 12554-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 12554-2-AP (PPP2CB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of rat kidney using 12554-2-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12554-2-AP (PPP2CB antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PPP2CB Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12554-2-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform, PP2CB, PP2A-beta, PP2A beta, EC:3.1.3.16

---

Tested Applications

• Positive WB detected in: mouse lung tissue, U2OS cells
• Positive IP detected in: NIH/3T3 cells
• Positive IHC detected in: rat kidney tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• CoIP: See 2 publications below

Product Information

12554-2-AP targets PPP2CB in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3233

  Product name: Recombinant human PPP2CB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-309 aa of BC012022

  Sequence: MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

• Full Name: protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform
• Calculated Molecular Weight: 309 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC012022
• Gene Symbol: PPP2CB
• Gene ID (NCBI): 5516
• RRID: AB_2169651
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,CoIP	Cell Mol Life Sci; GADD45α alleviates acetaminophen-induced hepatotoxicity by promoting AMPK activation.; Authors - Chunmin Li ; KD Validated
human	WB	Front Cell Dev Biol; BRG1 Activates PR65A Transcription to Regulate NO Bioavailability in Vascular Endothelial Cells.; Authors - Baoyu Chen
human	WB,CoIP	Cell Signal; METTL14-mediated N6-methyladenosine modification of TCP1 mRNA promotes acute myeloid leukemia progression; Authors - Mengmeng Zhang