PPP2R2A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PPP2R2A Polyclonal antibody (16569-1-AP)

PPP2R2A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16569-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

B55 ALPHA, B55A, PP2A subunit B isoform alpha, PPP2R2A, PR52A, PR55A

• 

  WB analysis using 16569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16569-1-AP (PPP2R2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16569-1-AP (PPP2R2A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16569-1-AP (PPP2R2A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16569-1-AP (PPP2R2A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 16569-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PPP2R2A antibody (16569-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PPP2R2A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells, C6 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16569-1-AP targets PPP2R2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9851

  Product name: Recombinant human PPP2R2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-447 aa of BC041071

  Sequence: IRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN

• Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
• Calculated Molecular Weight: 477 aa, 52 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC041071
• Gene Symbol: PPP2R2A
• Gene ID (NCBI): 5520
• RRID: AB_2878280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63151
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The serine/threonine protein phosphatase 2A (PP2A) is a master regulator of the complex cellular signaling that occurs during all stages of mammalian development. PPP2R2A, also known as B55A or PR55A, is a regulatory subunit of PP2A expressed in an Akt-dependent manner in epidermis during barrier formation. PPP2R2A participates in the negative control of cell growth and division. PPP2R2A has been proved to be a tumor suppressor that can inhibit the proliferation of a variety of cancer cells, such as prostate cancer cells(PMID: 21872824).

Publications

What published studies show

The PPP2R2A polyclonal antibody (Cat# 16569-1-AP) has 7 citations published in Nature Communications, J Exp Clin Cancer Res, Environ Pollut, EMBO Rep, Cell Div, Cell Physiol Biochem, and Herz. Research fields span neuroscience (axon initial segment signaling), oncology (hepatocellular carcinoma, lung cancer), environmental toxicology, psychiatry (depression), obstetrics (preeclampsia), and cardiology (myocardial ischemia/reperfusion injury). Applications cited include WB and IF across human, mouse, and rat species.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; A distinct PP2A subunit regulates local protein phosphorylation at the axon initial segment.; Authors - Andrew P. Anderson
human	IF	J Exp Clin Cancer Res; Non-canonical activation of MAPK signaling by the lncRNA ASH1L-AS1-encoded microprotein APPLE through inhibition of PP1/PP2A-mediated ERK1/2 dephosphorylation in hepatocellular carcinoma; Authors - Lei Zhao
human	WB	Environ Pollut; The role of miR-222-2p in exosomes secreted by hexavalent chromium-induced premature senescent hepatocytes as a SASP component; Authors - Yu Ma
mouse	WB	EMBO Rep; CIP2A deficiency promotes depression-like behaviors in mice through inhibition of dendritic arborization; Authors - Wen-Ting Hu
human	WB	Cell Div; PPP2R2A inhibition contributes to preeclampsia by regulating the proliferation, apoptosis, and angiogenesis modulation potential of mesenchymal stem cells; Authors - Yan Liu
human	WB	Cell Physiol Biochem; Quantitative Proteomic Analysis of the Metastasis-Inhibitory Mechanism of miR-193a-3p in Non-Small Cell Lung Cancer.; Authors - Wei Deng