PPP2R2A Polyclonal antibody

• 

  WB analysis using 16569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16569-1-AP (PPP2R2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16569-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16569-1-AP (PPP2R2A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 16569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16569-1-AP (PPP2R2A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 16569-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16569-1-AP (PPP2R2A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 16569-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PPP2R2A antibody (16569-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

PPP2R2A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16569-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

B55 ALPHA, B55A, PP2A subunit B isoform alpha, PPP2R2A, PR52A, PR55A

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells, C6 cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

16569-1-AP targets PPP2R2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9851

  Product name: Recombinant human PPP2R2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-447 aa of BC041071

  Sequence: IRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN

• Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
• Calculated Molecular Weight: 477 aa, 52 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC041071
• Gene Symbol: PPP2R2A
• Gene ID (NCBI): 5520
• RRID: AB_2878280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63151
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The serine/threonine protein phosphatase 2A (PP2A) is a master regulator of the complex cellular signaling that occurs during all stages of mammalian development. PPP2R2A, also known as B55A or PR55A, is a regulatory subunit of PP2A expressed in an Akt-dependent manner in epidermis during barrier formation. PPP2R2A participates in the negative control of cell growth and division. PPP2R2A has been proved to be a tumor suppressor that can inhibit the proliferation of a variety of cancer cells, such as prostate cancer cells(PMID: 21872824).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Physiol Biochem; Quantitative Proteomic Analysis of the Metastasis-Inhibitory Mechanism of miR-193a-3p in Non-Small Cell Lung Cancer.; Authors - Wei Deng
mouse	WB	EMBO Rep; CIP2A deficiency promotes depression-like behaviors in mice through inhibition of dendritic arborization; Authors - Wen-Ting Hu
human	WB	Environ Pollut; The role of miR-222-2p in exosomes secreted by hexavalent chromium-induced premature senescent hepatocytes as a SASP component; Authors - Yu Ma
human	WB	Cell Div; PPP2R2A inhibition contributes to preeclampsia by regulating the proliferation, apoptosis, and angiogenesis modulation potential of mesenchymal stem cells; Authors - Yan Liu