PPP2R3B Polyclonal antibody

• 

  WB analysis of HL-60 using 24502-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 24502-1-AP (PPP2R3B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24502-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24502-1-AP (PPP2R3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PPP2R3B Polyclonal Antibody for WB, ELISA

Cat No. 24502-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NY REN 8, PP2A subunit B isoform PR48, PPP2R3B, PPP2R3L, PPP2R3LY, PR48

---

Tested Applications

• Positive WB detected in: HL-60 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24502-1-AP targets PPP2R3B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21366

  Product name: Recombinant human PPP2R3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 400-575 aa of BC009032

  Sequence: MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

• Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC009032
• Gene Symbol: PPP2R3B
• Gene ID (NCBI): 28227
• RRID: AB_2879577
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5P8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.