PPP3CA Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PPP3CA Recombinant monoclonal antibody, PBS Only (87902-1-PBS)

PPP3CA Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 87902-1-PBS

Clone No.253412F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CALNA, Calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNA1

• 

  WB analysis using 87902-1-RR (same clone as 87902-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87902-1-RR (PPP3CA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87902-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 87902-1-RR (same clone as 87902-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 87902-1-RR (PPP3CA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87902-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 87902-1-RR (same clone as 87902-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 87902-1-RR (PPP3CA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87902-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 87902-1-RR (same clone as 87902-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using PPP3CA antibody (87902-1-RR, Clone: 253412F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87902-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87902-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87902-1-RR against Human PPP3CA were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87902-1-PBS targets PPP3CA in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4203

  Product name: Recombinant human PPP3CA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 3-302 aa of BC025714

  Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL

• Full Name: protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC025714
• Gene Symbol: PPP3CA
• Gene ID (NCBI): 5530
• RRID: AB_3745817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08209
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.