PPP4R1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67392-1-Ig (same clone as 67392-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67392-1-Ig (PPP4R1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67392-1-Ig (same clone as 67392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67392-1-Ig (PPP4R1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67392-1-Ig (same clone as 67392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67392-1-Ig (PPP4R1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67392-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67392-1-Ig (same clone as 67392-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using PPP4R1 antibody (67392-1-Ig, Clone: 3D12G12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67392-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 67392-1-Ig (same clone as 67392-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using PPP4R1 antibody (67392-1-Ig, Clone: 3D12G12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67392-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67392-1-Ig (same clone as 67392-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human PPP4R1 (67392-1-Ig, Clone:3D12G12) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67392-1-PBS in a different storage buffer formulation.

PPP4R1 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 67392-1-PBS

Clone No.3D12G12

Host / Isotype

Mouse / IgG1

Reactivity

rat, mouse, human

Applications

WB, IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

Serine/threonine-protein phosphatase 4 regulatory subunit 1, PP4R1, PP4(Rmeg), MEG1, 3D12G12

---

Product Information

67392-1-PBS targets PPP4R1 in WB, IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with rat, mouse, human samples.

• Tested Reactivity: rat, mouse, human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26750

  Product name: Recombinant human PPP4R1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 331-520 aa of BC060829

  Sequence: NRTRDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRAS

• Full Name: protein phosphatase 4, regulatory subunit 1
• Calculated Molecular Weight: 107 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC060829
• Gene Symbol: PPP4R1
• Gene ID (NCBI): 9989
• RRID: AB_2882636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8TF05
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.