PPP6C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPP6C Polyclonal antibody, PBS Only (15852-1-PBS)

• 

  WB analysis using 15852-1-AP (same clone as 15852-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15852-1-AP (PPP6C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 15852-1-AP (same clone as 15852-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 15852-1-AP (PPP6C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 15852-1-AP (same clone as 15852-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15852-1-AP (PPP6C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 15852-1-AP (same clone as 15852-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15852-1-AP (PPP6C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 15852-1-AP (same clone as 15852-1-PBS)

  IP result of anti-PPP6C (IP:15852-1-AP, 3ug; Detection:15852-1-AP 1:500) with mouse testis tissue lysate 4000ug. This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15852-1-AP (same clone as 15852-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15852-1-AP (PPP6C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15852-1-AP (same clone as 15852-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15852-1-AP (PPP6C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15852-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PPP6C Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15852-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15852-1-PBS targets PPP6C in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8670

  Product name: Recombinant human PPP6C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-305 aa of BC006990

  Sequence: MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL

• Full Name: protein phosphatase 6, catalytic subunit
• Calculated Molecular Weight: 305 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC006990
• Gene Symbol: PPP6C
• Gene ID (NCBI): 5537
• RRID: AB_2168894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00743
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.