PPTC7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPTC7 Polyclonal antibody, PBS Only (21884-1-PBS)

• 

  WB analysis using 21884-1-AP (same clone as 21884-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21884-1-AP (PPTC7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21884-1-PBS in a different storage buffer formulation.

PPTC7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21884-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21884-1-PBS targets PPTC7 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16469

  Product name: Recombinant human PPTC7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-304 aa of BC111551

  Sequence: MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD

• Full Name: PTC7 protein phosphatase homolog (S. cerevisiae)
• Calculated Molecular Weight: 304 aa, 33 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC111551
• Gene Symbol: PPTC7
• Gene ID (NCBI): 160760
• RRID: AB_3669380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NI37
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPTC7 (Protein phosphatase PTC7 homolog, also named TAPP2C) is a resident mitochondrial phosphatase essential for maintaining proper mitochondrial content and function (PMID: 37833277).